General Information

  • ID:  hor000084
  • Uniprot ID:  P13389
  • Protein name:  Neurophysin 1
  • Gene name:  OXT
  • Organism:  Ovis aries (Sheep)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009612 response to mechanical stimulus; GO:0032094 response to food; GO:0043207 response to external biotic stimulus; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence Information

  • Sequence:  AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH
  • Length:  94
  • Propeptide:  MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH
  • Signal peptide:  MAGSSLACCLLGLLALTSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bind oxytocin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  10-54; 13-27; 21-44; 28-34; 61-73; 67-85; 74-79
  • Structure ID:  AF-P13389-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000084_AF2.pdbhor000084_ESM.pdb

Physical Information

Mass: 1118284 Formula: C392H615N119O130S14
Absent amino acids: MW Common amino acids: CG
pI: 4.66 Basic residues: 9
Polar residues: 38 Hydrophobic residues: 24
Hydrophobicity: -11.6 Boman Index: -12073
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.09
Instability Index: 4821.06 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.43

Literature

  • PubMed ID:  2095591
  • Title:  Structure and Ovarian Expression of the Oxytocin Gene in Sheep